PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016473039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 239aa    MW: 28045.1 Da    PI: 7.4057
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016473039.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.64.7e-1318941198
                    HHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3 11 lksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                    +k+g + +p  f+ ++ +   + +++  +  + +++W vk+  +++     l++GW++F+++++L+ gD++vF ++g++ef   v++f 
  XP_016473039.1 18 FKHG-IKIPLGFL-KYlKD--HDHIEHAILIRGSKKWLVKV--NGRH----LEEGWEKFAEDHDLQLGDMLVFGHEGNMEF--EVSIFH 94
                    4454.89999999.66332..3455667777789*******..6666....999**********************99999..888875 PP

2B352.58.7e-17137222594
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +++++ l++++l +pk+fa ++g+++++  +l+++de+ rsW++ +  r +s  +++++GW+e  + + LkegD ++F+++ + e++++ 
  XP_016473039.1 137 TVRPYCLQNDILNIPKQFAWANGLINKK-CDLIIRDERQRSWNLVV--RSYSTNVYISGGWNEIRDIHCLKEGDRIMFEVVAN-EKKPTW 222
                     5789999***************988654.59***************..*******************************9875.444554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-17398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-19498IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.66796IPR003340B3 DNA binding domain
CDDcd100179.68E-13893No hitNo description
SMARTSM010199.2E-121096IPR003340B3 DNA binding domain
PfamPF023628.0E-101994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-15132219IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.138133230IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-16133226IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.7E-14134228IPR003340B3 DNA binding domain
PfamPF023621.7E-13137224IPR003340B3 DNA binding domain
CDDcd100171.56E-10148212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKVSPNKPHF LKPILPGFKH GIKIPLGFLK YLKDHDHIEH AILIRGSKKW LVKVNGRHLE  60
EGWEKFAEDH DLQLGDMLVF GHEGNMEFEV SIFHSNQCER EYEEEQKVHN VEETSKKFEF  120
KGIDTHKLFS QSRFVCTVRP YCLQNDILNI PKQFAWANGL INKKCDLIIR DERQRSWNLV  180
VRSYSTNVYI SGGWNEIRDI HCLKEGDRIM FEVVANEKKP TWKFHAKSGE DASIIQEVD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016473039.11e-178PREDICTED: B3 domain-containing protein REM8-like
TrEMBLK4CIB31e-85K4CIB3_SOLLC; Uncharacterized protein
TrEMBLM1AKH36e-87M1AKH3_SOLTU; Uncharacterized protein
STRINGSolyc08g006240.1.14e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.12e-37B3 family protein